« Zurück
Startseite /
Recombinant Human Parathyroid hormone (PTH) (Active)

Recombinant Human Parathyroid hormone (PTH) (Active)

ArtNr	BM-RPC27008-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Thyroid Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Parathyroid Hormone, PTH, Parathormone, Parathyrin
Similar products	PTH, Parathormone, Parathyrin, Parathyroid Hormone
Lieferbar
Gene Name	PTH
Alternative Names	Parathyroid Hormone, PTH, Parathormone, Parathyrin
Uniprot	P01270
Source	E.coli
Expression Region	32-115aa
AA Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFV ALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEA DKADVNVLTKAKSQ
Sequence Info	Full Length of Mature Protein
Tag Info	Tag-Free
Theoretical MW	9 kDa
Purity	>95% as determined by SDS-PAGE.
Storage Buffer	Lyophilized from a 0.2 um Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0
Endotoxin Level	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	The ED50 as determined by its ability to induce cAMP accumulation in MC3T3?E1 mouse preosteoblast cells is less than 0.1 ug/ml
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor as parathyroid hormone and has major effects on development. Like most other protein hormones, parathyroid hormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packaged within the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secreted as a linear protein of 84 amino acids.
Function	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Involvement in disease	Hypoparathyroidism, familial isolated (FIH)
Subcellular location	Secreted
Protein Families	Parathyroid hormone family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern