Recombinant Mouse Macrophage migration inhibitory factor (Mif)

Delayed early response protein 6 (DER6) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC:5.3.3.12)) (Phenylpyruvate tautomerase) (MIF)

Yeast

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQ YIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGA QNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAAN VGWNGSTFA

N-terminal 6xHis-tagged

>90% as determined by SDS-PAGE.

Not tested

Ice packs

1 year

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity, but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.