« Zurück
Startseite /
Recombinant Mouse Pericentrin (Pcnt), partial

Recombinant Mouse Pericentrin (Pcnt), partial

ArtNr	BM-RPC26302-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pcnt2
Similar products	Pcnt2
Lieferbar
Gene Name	Pcnt
Alternative Names	Pcnt2
Uniprot	P48725
Source	E.coli
Expression Region	2545-2810aa
AA Sequence	LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMR TLEELKSELSMPTSFQKKMTAELQVQLMNELLSDN DALTKAVGMATREKAELCRTVSRLEKTLKHHTQKG CVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTS GDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLL LLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSR PFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALV HPKSTRHGHRTSQRQRSPSGP
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	37.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material. May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern