« Zurück
Startseite /
Recombinant Escherichia coli Arsenical resistance operon repressor (arsR)

Recombinant Escherichia coli Arsenical resistance operon repressor (arsR)

ArtNr	BM-RPC26011-50ug
Hersteller	Biomatik
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	arsE
Similar products	arsE
Lieferbar
Gene Name	arsR
Alternative Names	arsE
Uniprot	P37309
Source	E.coli
Expression Region	1-117aa
AA Sequence	MSFLLPIQLFKILADETRLGIVLLLSELGELCVCD LCTALDQSQPKISRHLALLRESGLLLDRKQGKWVH YRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLAR QNCSGDSKNICS
Sequence Info	Full Length
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	19.0 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V))
Function	Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V)) (By similarity).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 04.09.2025