« Zurück
Startseite /
Recombinant Pseudomonas aeruginosa Type III export protein PscF (pscF)

Recombinant Pseudomonas aeruginosa Type III export protein PscF (pscF)

ArtNr	BM-RPC26096-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pseudomonas secretion protein F
Similar products	Pseudomonas secretion protein F
Lieferbar
Gene Name	pscF
Alternative Names	Pseudomonas secretion protein F
Uniprot	P95434
Source	E.coli
Expression Region	2-85aa
AA Sequence	AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIK ALQGTDNADNPALLAELQHKINKWSVIYNINSTVT RALRDLMQGILQKI
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	16.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.
Function	Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.
Subcellular location	Secreted
Protein Families	MxiH/PrgI/YscF family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern