Vergleich

Human recombinant IFN gamma protein, GMP Europäischer Partner

ArtNr BOS-PROTP01579-10-1mg
Hersteller Boster
Menge 1 mg
Quantity options 100 ug 1 mg
Kategorie
Format Lyophilized
Applikationen ELISA, Cell Culture
Specific against Human (Homo sapiens)
Konjugat/Tag HIS
Sequence MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus.
Alias Type II interferon,T-cell interferon,MAF
Lieferbar
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (C-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 17.7 kDa.
The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Calculated Molecular weight
The protein has a calculated MW of 17.7 kDa.The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
IFNG
Purification
>95% as determined by SDS-PAGE analysis.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.
Description
The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.
Bioactivity/Biological Activity
Measure by its ability to induce cytotoxicity in HT29 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 10⁶ IU/mg, which is calibrated against the human IFN Gamma WHO Reference Material (NIBSC code: 87/586).
Endotoxin level
<0.05 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen