« Zurück
Startseite /
Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

ArtNr	BOS-PROTP07200-20ug
Hersteller	Boster
Menge	20 ug
Quantity options	20 ug 5 ug
Kategorie	Oncology Neuroscience Neuroinflammation By Cell Type Carcinoma Cell Biology Cell Culture Cytokines Mesothelioma By Organ Colorectal Cancer Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Pig (Porcine, Sus scrofa domesticus)
Konjugat/Tag	HIS
Sequence	MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.
Alias	TGF-BETA-1,TGFB1
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 13.73 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 13.73 kDa.The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	TGFB1
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile 10 mM HCl to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Transforming Growth Factors beta 1 (TGF beta 1) is the cytokine of the TGF-beta family, which is a 12.5 kDa protein containing 113 amino acid residues. TGF beta 1 is produced by white blood cell which plays an important role in inflammation, cell proliferation and differentiation. TGF beta 1 also has several functions about cancer and auto-immune diseases. TGF-beta 1 not only can activate the smad signaling but also can induce the MAPK, Rhoa and RAS.
Bioactivity/Biological Activity	Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED₅₀ for this effect is <0.1 ng/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTP07200-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 04.12.2025