« Back
Home /
Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

Item no.	BOS-PROTP07200-20ug
Manufacturer	Boster
Amount	20 ug
Quantity options	20 ug 5 ug
Category	Oncology Neuroscience Neuroinflammation By Cell Type Carcinoma Cell Biology Cell Culture Cytokines Mesothelioma By Organ Colorectal Cancer Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Pig (Porcine, Sus scrofa domesticus)
Conjugate/Tag	HIS
Sequence	MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.
Alias	TGF-BETA-1,TGFB1
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 13.73 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 13.73 kDa.The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	TGFB1
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile 10 mM HCl to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Transforming Growth Factors beta 1 (TGF beta 1) is the cytokine of the TGF-beta family, which is a 12.5 kDa protein containing 113 amino acid residues. TGF beta 1 is produced by white blood cell which plays an important role in inflammation, cell proliferation and differentiation. TGF beta 1 also has several functions about cancer and auto-immune diseases. TGF-beta 1 not only can activate the smad signaling but also can induce the MAPK, Rhoa and RAS.
Bioactivity/Biological Activity	Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED₅₀ for this effect is <0.1 ng/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP07200-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time