Vergleich

Human recombinant TGF beta 2 (Transforming growth factor beta 2) protein, AF Europäischer Partner

ArtNr BOS-PROTP61812-4-20ug
Hersteller Boster
Menge 20 ug
Quantity options 100 ug 20 ug 5 ug
Kategorie
Format Lyophilized
Applikationen Cell Culture
Specific against Human (Homo sapiens)
Konjugat/Tag HIS
Sequence MALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS with polyhistidine tag at the C-terminus.
Alias G-TSF,LDS4,TGFB2
Lieferbar
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (C-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 13.66 kDa.
The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 13.66 kDa.The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
TGFB2
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile 10 mM HCl to a
concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least
20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Transforming Growth Factors beta 2 (TGFβ-2) is a 12.85 kDa member of the epidermal Growth Factors with 113 amino acid residues. TGFβ-2 is expressed from throughout the body. TGFβ-2 is a regulator of cell proliferation, differentiation, apoptosis, cell plasticity and migration, etc. TGF-β-2 also associates with various kinds of diseases, such as cancer and tissue fibrosis.
Bioactivity/Biological Activity
Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells.
The ED₅₀ for this effect is <0.2 ng/mL.
The specific activity of recombinant human TGF beta 2 is > 5 x 10⁶ IU/mg.
Endotoxin level
<0.01 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen