« Zurück
Startseite /
Anti-Toll-like Receptor 4 TLR4 Antibody

Anti-Toll-like Receptor 4 TLR4 Antibody

ArtNr	BOS-A00017
Hersteller	Boster
Menge	200 ug
Kategorie	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Antibodies Obesity Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies
Typ	Antibody
Format	Liquid
Applikationen	IF, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Caprine
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Manufacturer - Category	Primary Antibodies
Storage Conditions	Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.
Manufacturer - Format	Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Clonality	Polyclonal
Application Details	Immunocytochemistry (acetone fixed cells, >1:400) Immunohistochemistry (paraffin sections, >1:250) Western Blot (>1:1, 000) Suggested dilutions/conditions may not be available for all applications. Optimal conditions must be determined individually for each application.
Manufacturer - Gene Name	TLR4
Immunogen	Synthetic peptide corresponding to aa 161-192 (L¹⁶¹IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC¹⁹²) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .
Contents	Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Purification	Epitope-affinity purified IgG.
Concentration	0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Manufacturer - Research Category	Host-Virus Interaction, Immunoglobulins, Immunology, Innate Immunity, Interspecies Interaction, Macrophage/Inflammation, Microbiology, Receptors, TLR Signaling, Vascular Inflammation
Short Description	Boster Bio Anti-Toll-like Receptor 4 TLR4 Antibody catalog # A00017. Tested in IF, IHC applications. This antibody reacts with Human, Mouse.
Description	Boster Bio Anti-Toll-like Receptor 4 TLR4 Antibody catalog # A00017. Tested in IF, IHC applications. This antibody reacts with Human, Mouse.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-A00017-datasheet.pdf

BOS-A00017-safety-datasheet.pdf