« Back
Home /
Anti-Toll-like Receptor 4 TLR4 Antibody

Anti-Toll-like Receptor 4 TLR4 Antibody

Item no.	BOS-A00017
Manufacturer	Boster
Amount	200 ug
Category	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Antibodies Obesity Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies
Type	Antibody
Format	Liquid
Applications	IF, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Caprine
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Manufacturer - Category	Primary Antibodies
Storage Conditions	Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.
Manufacturer - Format	Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Clonality	Polyclonal
Application Details	Immunocytochemistry (acetone fixed cells, >1:400) Immunohistochemistry (paraffin sections, >1:250) Western Blot (>1:1, 000) Suggested dilutions/conditions may not be available for all applications. Optimal conditions must be determined individually for each application.
Manufacturer - Gene Name	TLR4
Immunogen	Synthetic peptide corresponding to aa 161-192 (L¹⁶¹IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC¹⁹²) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .
Contents	Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Purification	Epitope-affinity purified IgG.
Concentration	0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Manufacturer - Research Category	Host-Virus Interaction, Immunoglobulins, Immunology, Innate Immunity, Interspecies Interaction, Macrophage/Inflammation, Microbiology, Receptors, TLR Signaling, Vascular Inflammation
Short Description	Boster Bio Anti-Toll-like Receptor 4 TLR4 Antibody catalog # A00017. Tested in IF, IHC applications. This antibody reacts with Human, Mouse.
Description	Boster Bio Anti-Toll-like Receptor 4 TLR4 Antibody catalog # A00017. Tested in IF, IHC applications. This antibody reacts with Human, Mouse.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-A00017-datasheet.pdf

BOS-A00017-safety-datasheet.pdf