Vergleich

Zinc Finger Protein 100 Recombinant Protein

ArtNr PRS-91-993-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against other
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice Yes
Sequence MGSSHHHHHHSSGLVPRGSHMRHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK
NCBI ZNF100
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Zinc Finger Protein 100, ZNF100
Lieferbar
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag
N-6 His tag
Storage Conditions
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight
15 kD
Background
Zinc Finger Protein 100 (ZNF100) is part of the krueppel C2H2-type zinc-finger protein family. ZNF100 contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF100 is a DNA-binding protein domain consisting of zinc fingers. Zinc finger protein 100 occurs in nature as the part of transcription factors conferring DNA sequence specificity as the DNA-binding domain. Zinc finger proteins have also found use in protein engineering due to their modularity and have prospects as components of tools for use in therapeutic gene modulation and zinc finger nucleases.
Protein Gi #
929654682
Buffer
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, 1mM ZnCl2, 30% Glycerol, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name
zinc finger protein 100
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen