Vergleich

Anti-FGFR1 Picoband Antibody

ArtNr ABC-ABO10017
Hersteller Abcepta
Menge 100 ug
Kategorie
Typ Antibody Primary
Format Lyophilized
Applikationen WB
Specific against other
Host Rabbit
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Similar products FGFR1, Fibroblast growth factor receptor 1, Basic fibroblast growth factor receptor 1, Proto-oncogene c-Fgr, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR, Fms-like tyrosine kinase 2, N-sam, CD331, FGFR-1, FLT-2, bFGF-R-1, 2.7.10.1
Lieferbar
Primary Accession
P11362
Application
WB
Clonality
Polyclonal
Gene ID
2260
Reactivity
H
Legend image 1
Western blot analysis of FGFR1 expression in HEPG2 whole cell lysates (lane 1). FGFR1 at 100KD was detected using rabbit anti- FGFR1 Antigen Affinity purified polyclonal antibody (Catalog # ABO10017) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1
WB
Dilution image 1
0.1-0.5 µg/ml
Calculated MW
91868
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description
Rabbit IgG polyclonal antibody for Fibroblast growth factor receptor 1(FGFR1) detection. Tested with WB in Human.
Protein Function
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1, 4, 5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation. .
Subcellular Localization
Cell membrane; Single-pass type I membrane protein. Nucleus. Cytoplasm, cytosol. Cytoplasmic vesicle. After ligand binding, both receptor and ligand are rapidly internalized. Can translocate to the nucleus after internalization, or by translocation from the endoplasmic reticulum or Golgi apparatus to the cytosol, and from there to the nucleus.
Tissue Specificity
Detected in astrocytoma, neuroblastoma and adrenal cortex cell lines. Some isoforms are detected in foreskin fibroblast cell lines, however isoform 17, isoform 18 and isoform 19 are not detected in these cells. .
Protein Name
Fibroblast growth factor receptor 1
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FGFR1 (489-520aa FGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDA), identical to the related mouse and rat sequences.
Purification
Immunogen affinity purified.
Cross Reactivity
No cross reactivity with other proteins.
Storage
At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen