Anti-TFAP2C Antibody

ArtNr	ANTI-A15864-50
Hersteller	Antibodies.com
Menge	50ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Sequence	NMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Product Description	Rabbit polyclonal antibody to AP2 gamma / TFAP2C.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TFAP2C (NP_003213.1).
Product form	Liquid
Molecular weight	49 kDa
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:500-1:2, 000
Target	AP2 gamma / TFAP2C

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern