« Zurück
Startseite /
Recombinant Human PLA2R1 Protein (Functional)

Recombinant Human PLA2R1 Protein (Functional)

ArtNr	ANTI-A122162-50
Hersteller	Antibodies.com
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid
Applikationen	WB, SDS-PAGE
Specific against	other
Konjugat/Tag	HIS
Purity	> 95% (by SDS-PAGE).
Sequence	AEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLTLENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMFPFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSHICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDET
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Concentration	Lot specific.
Product form	Liquid
Formulation	Supplied in Phosphate Buffered Saline with 20% Glycerol.
Protein Length	Protein fragment.
Amino acids	21 to 663
Purification	Affinity chromatography.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C or -70°C. Avoid freeze / thaw cycles.
Target	PLA2R1
Protein species	Human
Tag	His Tag (10xHis at the C-terminus).
Endotoxin level	< 0.1 ng/µg (1 IEU/µg), as measured by LAL method.
Expression system	HEK293 cells.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern