Vergleich

PI3 Kinase p85 alpha/beta Rabbit mAb Europäischer Partner

ArtNr A22487-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT
NCBI PIK3R1/PIK3R2
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias PIK3R1/PIK3R2, PI3 Kinase p85 alpha/beta
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Background
Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1).
Recommended Dilution
WB, 1:1000 - 1:5000
Protein Size
42-54kDa/81-84kDa
Route
Synthetic peptide
Manufacturer - Research Area
Protein phosphorylation, Protein phosphorylation, Protein phosphorylation

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen