« Zurück
Startseite /
Recombinant Human Leptin/LEP Protein

Recombinant Human Leptin/LEP Protein

ArtNr	RP00028-50ug
Hersteller	Abclonal
Menge	50 ug
Quantity options	10 ug 20 ug 50 ug 5 ug
Specific against	Human (Homo sapiens)
Purity	> 92% by SDS-PAGE.
NCBI	Leptin/LEP
Alias	LEP,LEPD,OB,OBS,leptin
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	16.03 kDa
Description	Recombinant Human Leptin/LEP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Cys167) of human Leptin (Accession #NP_000221.1).
Background	Leptin is one of the most important hormones secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this protein and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This protein has also been linked to type 2 diabetes mellitus development.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Val22-Cys167
Route	No tag
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Leptin at 2 μg/mL (100 μL/well) can bind Recombinant Human Leptin R/CD295 with a linear range of 1. 22-261. 45 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Expected Protein Size	16.03 kDa
Gene Symbol	Leptin/LEP

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00028-50ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern