« Zurück
Startseite /
Recombinant Cyanophora paradoxa Chaperone protein dnaK(dnaK-A),partial

Recombinant Cyanophora paradoxa Chaperone protein dnaK(dnaK-A),partial

ArtNr	CSB-EP656399DZX-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neuroinflammation Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	GEVKDIVLLDVTPLSLGVETLGGVMSKIIVRNTTI PTQKSELFSTATDGQTNVEIHVLQGERGFAKDNKS LGTFRLDGIAPAPRGVPQIEVTFDIDANGILSVTA KDKGTGKEKSITITGASTLSQDEVERMVQEAEKNA AQDKENRQKIELRNQAE
Protein Familie	Heat shock protein 70 family
Citations	"The complete sequence of the cyanelle genome of Cyanophora paradoxa: the genetic complexity of a primitive plastid." Loeffelhardt W., Stirewalt V.L., Michalowski C.B., Annarella M., Farley J.Y., Schluchter W.M., Chung S., Newmann-Spallart C., Steiner J.M., Jakowitsch J., Bohnert H.J., Bryant D.A. (In) Schenk H.E.A., Herrmann R., Jeon K.W., Mueller N.E., Schwemmler W. (eds.); Eukaryotism and symbiosis, pp.40-48, Springer-Verlag, Heidelberg (1997)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSP70; Heat shock 70 kDa protein; Heat shock protein 70
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	21.9 kDa
General Research Areas	Signal Transduction
Relevance	Acts as a chaperone.
Expression Region	377-533aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a chaperone.
Subcellular Location	Plastid, cyanelle
Gene Names	dnaK-A
Sequence Info	Partial
Organism	Cyanophora paradoxa
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP656399DZX-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern