Vergleich

Recombinant Human VEGF 189

ArtNr CS-CRV114B
Hersteller Cell Sciences
Menge 5 ug
Kategorie
Typ Proteins
Specific against Human (Homo sapiens)
Host E.coli
Purity >98% by SDS-PAGE and visualized by silver stain.
Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Similar products VEGF, VPF, RP1-261G23.1, MGC70609, MVCD1, vascular permeability factor, vascular endothelial growth factor A, OTTHUMP00000165987, OTTHUMP00000224107
Lieferbar
Manufacturer - Category
Biomolecules
Storage Conditions
The lyophilized protein is stable for a few weeks at room temperature, but is best stored at -20C to -80C. After reconstitution, store in working aliquots at -20C. Avoid repeated freeze-thaw cycles.
Molecular Weight
ca.42 kDa
Description
Human Vascular Endothelial Growth Factor (VEGF189), a 21 kDa protein consisting of 189 amino acid residues, is produced as a homodimer. VEGF is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor, in vivo . Two high-affinity tyrosine kinase receptors for VEGF165 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (KDR). Consistent with the endothelial cell-specific action of VEGF165, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vasular permeability factor (VPF), in vivo . VEGF165 is also a chemoattractant molecule for monocytes and endothelial cells. Five different proteins are generated by diffential splicing: VEGF121, VEGF145, VEGF165, VEGF189 and VEGF206. The most abdundant form is VEGF165. Whereas VEGF121 and VEGF165 are secreted proteins, VEGF145, VEGF189 and VEGF206 are strongly cell-associated. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity. VEGF165 is apparently a homodimer, but preparations of VEGF165 show some heterogeneity on SDS gels, depending on the secretion of different glycosylation patterns. All dimeric forms have similar biological activities but their bio-availability is very different. There is good evidence that heterodimeric molecules between the different isoforms also exist and that different cells and tissues express different VEGF isoforms. The other members of this increasing growth factor family are VEGF-B, -C, -D and -E. Another member is the Placenta growth factor PlGF.
Formulation
Lyophilized from a buffered solution of 50 mM Acetic Acid
Reconstitution
Centrifuge vial prior to opening. Reconstitute in water to a concentration no less than 50 ug/ml. For long term storage, we recommend adding at least 0.1% HSA or BSA.
Biological Activity
Measured by the stimulation of cell proliferation in human uMbilical vein endothelial cells in the range of 2-20 ng/ml.
Endotoxin Level
< 0.1 ng/ug of VEGF189

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 04.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen