Vergleich

Recombinant Bovine Retinol-binding protein 3(RBP3),partial

ArtNr CSB-YP019482BO-500
Hersteller Cusabio
Menge 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host Yeast
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SLGELVEGTGRLLEAHYARPEVVGQMGALLRAKLA QGAYRTAVDLESLASQLTADLQEMSGDHRLLVFHS PGEMVAEEAPPPPPVVPSPEELSYLIEALFKTEVL PGQLGYLRFDAMAELETVKAVGPQLVQLVWQKLVD TAALVVDLRYNPGSYSTAVPLLCSYFFEAEPRRHL YSVFDRATSRVTEVWTLPHVTGQRYGSHKDLYVLV SHTSGSAAEAFAHTMQDLQRATIIGEPTAGGALSV GIY
Protein Familie Peptidase S41A family
Citations Interphotoreceptor retinoid-binding protein. Gene characterization, protein repeat structure, and its evolution.Borst D.E., Redmond T.M., Elser J.E., Gonda M.A., Wiggert B., Chader G.J., Nickerson J.M.J. Biol. Chem. 264:1115-1123(1989)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interphotoreceptor retinoid-binding protein ,IRBPInterstitial retinol-binding protein,Protein 7S
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
66.8 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Expression Region
633-1231aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Subcellular Location
Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix
Gene Names
RBP3
Sequence Info
Partial
Organism
Bos taurus (Bovine)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen