« Zurück
Startseite /
Recombinant Bovine Retinol-binding protein 3(RBP3),partial

Recombinant Bovine Retinol-binding protein 3(RBP3),partial

ArtNr	CSB-YP019482BO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SLGELVEGTGRLLEAHYARPEVVGQMGALLRAKLA QGAYRTAVDLESLASQLTADLQEMSGDHRLLVFHS PGEMVAEEAPPPPPVVPSPEELSYLIEALFKTEVL PGQLGYLRFDAMAELETVKAVGPQLVQLVWQKLVD TAALVVDLRYNPGSYSTAVPLLCSYFFEAEPRRHL YSVFDRATSRVTEVWTLPHVTGQRYGSHKDLYVLV SHTSGSAAEAFAHTMQDLQRATIIGEPTAGGALSV GIY
Protein Familie	Peptidase S41A family
Citations	Interphotoreceptor retinoid-binding protein. Gene characterization, protein repeat structure, and its evolution.Borst D.E., Redmond T.M., Elser J.E., Gonda M.A., Wiggert B., Chader G.J., Nickerson J.M.J. Biol. Chem. 264:1115-1123(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interphotoreceptor retinoid-binding protein ;IRBPInterstitial retinol-binding protein;Protein 7S
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	66.8 kDa
Relevance	IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Expression Region	633-1231aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Subcellular Location	Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix
Gene Names	RBP3
Sequence Info	Partial
Organism	Bos taurus (Bovine)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP019482BO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern