Vergleich

Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial (Active)

ArtNr CSB-AP004971HU-50
Hersteller Cusabio
Menge 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Konjugat/Tag HIS
Purity Greater than 95% as determined by SDS-PAGE.
Sequence IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNS ICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTA SENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCG CRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEK QNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCL PQIENVKGTEDSGTT
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor receptor superfamily member 1A;Tumor necrosis factor receptor 1;TNF-R1;Tumor necrosis factor receptor type I;TNF-RI;TNFR-I;TNFAR; TNFR1
Lieferbar
Manufacturer - Category
Cytokine / Tumor Necrosis Factor
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
23.5 kDa
General Research Areas
Cancer
Relevance
Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome
Function
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted
Involvement in disease
Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5)
Paythway
MAPKsignalingpathway
Gene Names
TNFRSF1A
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Expression Region
22-211aa
Protein Description
Partial
Biological Activity
The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L?929 mouse fibroblast cells is less than 500 ng/ml in the presence of the metabolic inhibitor actinomycin D.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

 
Schließen