Vergleich

Recombinant Human Fructose-bisphosphate aldolase A(ALDOA)

ArtNr CSB-RP000154h-1
Hersteller Cusabio
Menge 1 mg
Quantity options 1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PYQYPALTPEQKKELSDIAHRIVAPGKGILAADES TGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN PCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVG IKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKD GADFAKWRCVLKIGEHTPSALAIMENANVLARYAS ICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLA AVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSH EEI
Protein Familie Class I fructose-bisphosphate aldolase family
Citations Nucleotide sequence of a cDNA clone for human aldolase a messenger RNA in the liver.Sakakibara M., Mukai T., Hori K.Biochem. Biophys. Res. Commun. 131:413-420(1985)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Lung cancer antigen NY-LU-1Muscle-type aldolase
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
66.3 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Metabolism
Relevance
Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein .
Expression Region
2-364aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein (By similarity).
Subcellular Location
Cytoplasm, myofibril, sarcomere, I band, Cytoplasm, myofibril, sarcomere, M line
Involvement in disease
Glycogen storage disease 12 (GSD12)
Pathway
HIF-1signalingpathway
Gene Names
ALDOA
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen