« Zurück
Startseite /
Recombinant Human Fructose-bisphosphate aldolase A(ALDOA)

Recombinant Human Fructose-bisphosphate aldolase A(ALDOA)

ArtNr	CSB-RP000154h-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PYQYPALTPEQKKELSDIAHRIVAPGKGILAADES TGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN PCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVG IKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKD GADFAKWRCVLKIGEHTPSALAIMENANVLARYAS ICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLA AVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSH EEI
Protein Familie	Class I fructose-bisphosphate aldolase family
Citations	Nucleotide sequence of a cDNA clone for human aldolase a messenger RNA in the liver.Sakakibara M., Mukai T., Hori K.Biochem. Biophys. Res. Commun. 131:413-420(1985)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Lung cancer antigen NY-LU-1Muscle-type aldolase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	66.3 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Metabolism
Relevance	Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein .
Expression Region	2-364aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein (By similarity).
Subcellular Location	Cytoplasm, myofibril, sarcomere, I band, Cytoplasm, myofibril, sarcomere, M line
Involvement in disease	Glycogen storage disease 12 (GSD12)
Pathway	HIF-1signalingpathway
Gene Names	ALDOA
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern