« Zurück
Startseite /
Recombinant Human Alpha-enolase(ENO1),partial

Recombinant Human Alpha-enolase(ENO1),partial

ArtNr	CSB-RP023944h-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Proteins Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Astrocyte Markers
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVP SGASTGIYEALELRDNDKTRYMGKGVSKAVEHINK TIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKF GANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNS EVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAA NFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEG GFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDV AAS
Protein Familie	Enolase family
Citations	Molecular cloning and nucleotide sequence of a full-length cDNA for human alpha enolase.Giallongo A., Feo S., Moore R., Croce C.M., Showe L.C.Proc. Natl. Acad. Sci. U.S.A. 83:6741-6745(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	2-phospho-D-glycerate hydro-lyaseC-myc promoter-binding protein;Enolase 1MBP-1MPB-1Non-neural enolase ;NNEPhosphopyruvate hydratasePlasminogen-binding protein
Lieferbar
Manufacturer - Targets	ENO1
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	73.4 kDa
General Research Areas	Metabolism
Relevance	Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic syst due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
Expression Region	2-428aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.; FUNCTION
Subcellular Location	Cytoplasm, Cell membrane, Cytoplasm, myofibril, sarcomere, M line
Tissue Specificity	The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
Paythway	HIF-1signalingpathway
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 18.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern