« Zurück
Home /
Recombinant Human Alpha-enolase(ENO1),partial

Recombinant Human Alpha-enolase(ENO1),partial

Hersteller	Cusabio
Kategorie	Food Safety Proteins Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Astrocyte Markers
Typ	Proteins Recombinant
Specific against	other
Menge	200ug
Host	E.coli
ArtNr	CSB-RP023944h-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Metabolism
Target / Protein	ENO1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P06733
AA Sequence	SILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVP SGASTGIYEALELRDNDKTRYMGKGVSKAVEHINK TIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKF GANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNS EVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAA NFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEG GFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDV AASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYK SFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVV GDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVT ESLQACKLAQANGWGVMVSHRSGETEDTFIADLVV GLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKA KFAGRNF
Tag Info	N-terminal GST-tagged
Expression Region	2-428aa
Protein length	Partial
MW	73.4 kDa
Alternative Name(s)	2-phospho-D-glycerate hydro-lyaseC-myc promoter-binding protein; Enolase 1MBP-1MPB-1Non-neural enolase ; NNEPhosphopyruvate hydratasePlasminogen-binding protein
Relevance	Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic syst due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
References	Molecular cloning and nucleotide sequence of a full-length cDNA for human alpha enolase.Giallongo A., Feo S., Moore R., Croce C.M., Showe L.C.Proc. Natl. Acad. Sci. U.S.A. 83:6741-6745(1986)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.; FUNCTION
Subcellular Location	Cytoplasm, Cell membrane, Cytoplasm, myofibril, sarcomere, M line
Protein Families	Enolase family
Tissue Specificity	The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
Paythway	HIF-1signalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen