Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-RP034844h-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Transport |
Uniprot ID |
P60520 |
Gene Names |
GABARAPL2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEK VSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL PSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFL YVAYSGENTFGF |
Expression Region |
1-117aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
40.7 kDa |
Alternative Name(s) |
GABA(A) receptor-associated protein-like 2Ganglioside expression factor 2 ; GEF-2General protein transport factor p16Golgi-associated ATPase enhancer of 16KDA ; GATE-16MAP1 light chain 3-related protein |
Relevance |
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 . Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. |
Reference |
Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain possible role of vesicular transport in axonal elongation.Okazaki N., Yan J., Yuasa S., Ueno T., Kominami E., Masuho Y., Koga H., Muramatsu M.-A.Brain Res. Mol. Brain Res. 85:1-12(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 (By similarity). Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. |
Subcellular Location |
Golgi apparatus, Cytoplasmic vesicle, autophagosome |
Protein Families |
ATG8 family |
Tissue Specificity |
Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine. |
Paythway |
Autophagy-animal |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.