Comparison

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2(GABARAPL2)

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP034844h-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
P60520
Gene Names
GABARAPL2
Organism
Homo sapiens (Human)
AA Sequence
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEK VSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL PSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFL YVAYSGENTFGF
Expression Region
1-117aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
40.7 kDa
Alternative Name(s)
GABA(A) receptor-associated protein-like 2Ganglioside expression factor 2 ; GEF-2General protein transport factor p16Golgi-associated ATPase enhancer of 16KDA ; GATE-16MAP1 light chain 3-related protein
Relevance
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 . Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Reference
Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain possible role of vesicular transport in axonal elongation.Okazaki N., Yan J., Yuasa S., Ueno T., Kominami E., Masuho Y., Koga H., Muramatsu M.-A.Brain Res. Mol. Brain Res. 85:1-12(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 (By similarity). Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Subcellular Location
Golgi apparatus, Cytoplasmic vesicle, autophagosome
Protein Families
ATG8 family
Tissue Specificity
Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine.
Paythway
Autophagy-animal

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close