« Zurück
Startseite /
Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial(NDUFV2),partial

Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial(NDUFV2),partial

ArtNr	CSB-RP053854h-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKN YPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEV LQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTP CMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEV ECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELK AGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFG VQAGL
Protein Familie	Complex I 24 kDa subunit family
Citations	Mitochondrial c-Src regulates cell survival through phosphorylation of respiratory chain components.Ogura M., Yamaki J., Homma M.K., Homma Y.Biochem. J. 447:281-289(2012)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	NADH-ubiquinone oxidoreductase 24KDA subunit
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	50.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Transport
Relevance	Core subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assbly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone .
Expression Region	35-249aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Subcellular Location	Mitochondrion inner membrane
Pathway	OxidativePhosphorylation
Gene Names	NDUFV2
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-RP053854h-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern