« Zurück
Home /
Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial(NDUFV2),partial

Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial(NDUFV2),partial

Hersteller	Cusabio
Kategorie	Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP053854h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transport
Uniprot ID	P19404
Gene Names	NDUFV2
Organism	Homo sapiens (Human)
AA Sequence	GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKN YPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEV LQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTP CMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEV ECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELK AGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFG VQAGL
Expression Region	35-249aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	50.6 kDa
Alternative Name(s)	NADH-ubiquinone oxidoreductase 24KDA subunit
Relevance	Core subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assbly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone .
Reference	Mitochondrial c-Src regulates cell survival through phosphorylation of respiratory chain components.Ogura M., Yamaki J., Homma M.K., Homma Y.Biochem. J. 447:281-289(2012)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Subcellular Location	Mitochondrion inner membrane
Protein Families	Complex I 24 kDa subunit family
Paythway	OxidativePhosphorylation
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen