« Zurück
Startseite /
Recombinant Human Ceruloplasmin(CP),partial

Recombinant Human Ceruloplasmin(CP),partial

ArtNr	CSB-RP145994h(c)-200
Hersteller	Cusabio
Menge	200 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQT ESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIP WAYYSTVDQVKDLYSGLIGPLIVCRRPYLKVFNPR RKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVN KDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEVN WYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVF DIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGM
Citations	Primary structure of a histidine-rich proteolytic fragment of human ceruloplasmin. I. Amino acid sequence of the cyanogen bromide peptides.Kingston I.B., Kingston B.L., Putnam F.W.J. Biol. Chem. 255:2878-2885(1980)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ferroxidase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 32
General Research Areas	Transport
Relevance	Ceruloplasmin is a blue, copper-binding (6-7 atoms per molecule) glycoprotein. It has ferroxidase activity oxidizing Fe2+ to Fe3+ without releasing radical oxygen species. It is involved in iron transport across the cell mbrane. Provides Cu2+ ions for the ascorbate-mediated deaminase degradation of the heparan sulfate chains of GPC1. May also play a role in fetal lung development or pulmonary antioxidant defense .
Expression Region	807-1050aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	CP
Sequence Info	Partial
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

nicht lieferbar