« Zurück
Startseite /
Recombinant Human Homeobox protein Hox-B4(HOXB4)

Recombinant Human Homeobox protein Hox-B4(HOXB4)

ArtNr	CSB-YP010664HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Brain Cancer Nervous System Cancer
Typ	Proteins Recombinant
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSP GYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRD PGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPE PGQRCEAVSSSPPPPPCAQNPLHPSPSHSACKEPV VYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVL ELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWF QNRRMKWKKDHKLPNTKIRSGGAAGSAGGPPGRPN GGP
Protein Familie	Antp homeobox family, Deformed subfamily
Citations	Expression of HOX homeogenes in human neuroblastoma cell culture lines.Peverali F.A., D'Esposito M., Acampora D., Bunone G., Negri M., Faiella A., Stornaiuolo A., Pannese M., Migliaccio E., Simeone A., Valle G.D., Boncinelli E.Differentiation 45:61-69(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Homeobox protein Hox-2.6Homeobox protein Hox-2F
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Transcription
Relevance	Sequence-specific transcription factor which is part of a developmental regulatory syst that provides cells with specific positional identities on the anterior-posterior axis.
Expression Region	1-251aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Subcellular Location	Nucleus
Gene Names	HOXB4
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP010664HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern