« Back
Home /
Recombinant Human Homeobox protein Hox-B4(HOXB4)

Recombinant Human Homeobox protein Hox-B4(HOXB4)

Item no.	CSB-YP010664HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Brain Cancer Nervous System Cancer
Type	Proteins Recombinant
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSP GYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRD PGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPE PGQRCEAVSSSPPPPPCAQNPLHPSPSHSACKEPV VYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVL ELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWF QNRRMKWKKDHKLPNTKIRSGGAAGSAGGPPGRPN GGP
Protein Family	Antp homeobox family, Deformed subfamily
Citations	Expression of HOX homeogenes in human neuroblastoma cell culture lines.Peverali F.A., D'Esposito M., Acampora D., Bunone G., Negri M., Faiella A., Stornaiuolo A., Pannese M., Migliaccio E., Simeone A., Valle G.D., Boncinelli E.Differentiation 45:61-69(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Homeobox protein Hox-2.6Homeobox protein Hox-2F
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Transcription
Relevance	Sequence-specific transcription factor which is part of a developmental regulatory syst that provides cells with specific positional identities on the anterior-posterior axis.
Expression Region	1-251aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Subcellular Location	Nucleus
Gene Names	HOXB4
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP010664HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 2/26/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer