Vergleich

Recombinant Mouse Vascular endothelial growth factor A(Vegfa),partial

ArtNr CSB-AP004161MO-500
Hersteller Cusabio
Menge 500 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity Greater than 95% as determined by SDS-PAGE.
Sequence APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIF QEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPT SESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRP KKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKN TDSRCKARQLELNERTCRCDKPRR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF; VEGFA; VEGFA164; VEGF164
Lieferbar
Manufacturer - Category
Cytokine / Growth Factor
Manufacturer - Conjugate / Tag
Tag-Free
Molecular Weight
19.27 kDa
General Research Areas
Cancer
Relevance
Mouse Vascular endothelial growth factor (VEGF or VEGF­A), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF/VEGF growth factor family that is characterized by a cystine knot structure formed by eight conserved cysteine residues. Alternately spliced isoforms of 120, 164 and 188 aa found in mouse. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt­1) and VEGF R2 (Flk­/KDR) on endothelial cells.Although affinity is highest for binding to VEGF R1, VEGF R2 appears to be the primary mediator of VEGF angiogenic activity. VEGF is required during embryogenesis to regulate the proliferation, migration, and survival of endothelial cells.It may play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis.
Gene Names
Vegfa
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Expression Region
27-190aa
Protein Description
Partial of Isoform 2
Biological Activity
The ED50 as determined in a cell proliferation assay using HUVEC human umbilical vein endothelial cells is less than 4ng/mL, corresponding to a specific activity of >= 2.5 x 105 units/mg.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

 
Schließen