« Zurück
Startseite /
Recombinant Mouse CD81 antigen(Cd81),partial

Recombinant Mouse CD81 antigen(Cd81),partial

ArtNr	CSB-EP004960MO-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Lymphatic System Cancer
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTF HETLNCCGSNALTTLTTTILRNSLCPSGGNILTPL LQQDCHQKIDELFSGK
Protein Familie	Tetraspanin (TM4SF) family
Citations	Possible involvement of CD81 in acrosome reaction of sperm in mice.Tanigawa M., Miyamoto K., Kobayashi S., Sato M., Akutsu H., Okabe M., Mekada E., Sakakibara K., Miyado M., Umezawa A., Miyado K.Mol. Reprod. Dev. 75:150-155(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1,CD81
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	36.4 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.
Expression Region	116-201aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.
Subcellular Location	Basolateral cell membrane, Multi-pass membrane protein
Tissue Specificity	Expressed in oocytes. Highly expressed in granulosa cells.
Gene Names	Cd81
Sequence Info	Partial
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP004960MO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 12.02.2026

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern