Vergleich

Recombinant Rat Sclerostin domain-containing protein 1(Sostdc1)

ArtNr CSB-BP734096RA-100
Hersteller Cusabio
Menge 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Rat (Rattus norvegicus)
Host Baculovirus-Infected Insect Cells
Konjugat/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence FKNDATEILYSHVVKPVSAHPSSNSTLNQARNGGR HFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSIS PLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSS QEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTAC KCKRYTRQHNESSHNFESVSPAKPAQHHRERKRAS KSSKHSLS
Protein Familie Sclerostin family
Citations Uterine sensitization-associated gene-1: a novel gene induced within the rat endometrium at the time of uterine receptivity/sensitization for the decidual cell reaction.
Simmons D.G., Kennedy T.G.
Biol. Reprod. 67:1638-1645(2002)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Uterine sensitization-associated gene 1 protein
Lieferbar
Manufacturer - Targets
Sostdc1
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
24.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Signal Transduction
Relevance
Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner. May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
Biologically Active
Not Test
Expression Region
24-206aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner (By similarity). May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
Subcellular Location
Secreted
Tissue Specificity
Highly expressed within the maximally sensitized/receptive endometrium. Weakly expressed in brain, kidney and the female reproductive tract. Expressed in the dermal papilla (DP) and at high level in the precortex of both anagen vibrissae and pelage follicles. Dynymic expression during the hair cycle.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen