Vergleich

Recombinant Rat Sclerostin domain-containing protein 1(Sostdc1)

ArtNr CSB-BP734096RA-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Baculovirus-Infected Insect Cells
Konjugat/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence FKNDATEILYSHVVKPVSAHPSSNSTLNQARNGGR HFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSIS PLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSS QEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTAC KCKRYTRQHNESSHNFESVSPAKPAQHHRERKRAS KSSKHSLS
Protein Familie Sclerostin family
Citations "Uterine sensitization-associated gene-1: a novel gene induced within the rat endometrium at the time of uterine receptivity/sensitization for the decidual cell reaction."
Simmons D.G., Kennedy T.G.
Biol. Reprod. 67:1638-1645(2002)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Uterine sensitization-associated gene 1 protein
Lieferbar
Manufacturer - Targets
Sostdc1
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
24.6 kDa
General Research Areas
Signal Transduction
Relevance
Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner. May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
Expression Region
24-206aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner (By similarity). May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
Subcellular Location
Secreted
Tissue Specificity
Highly expressed within the maximally sensitized/receptive endometrium. Weakly expressed in brain, kidney and the female reproductive tract. Expressed in the dermal papilla (DP) and at high level in the precortex of both anagen vibrissae and pelage follicles. Dynymic expression during the hair cycle.
Biologically active
Not Test
Protein length
Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen