« Zurück
Startseite /
Recombinant Mouse C-C chemokine receptor type 8(Ccr8)

Recombinant Mouse C-C chemokine receptor type 8(Ccr8)

ArtNr	CSB-CF004847MO-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MDYTMEPNVTMTDYYPDFFTAPCDAEFLLRGSMLY LAILYCVLFVLGLLGNSLVILVLVGCKKLRSITDI YLLNLAASDLLFVLSIPFQTHNLLDQWVFGTAMCK VVSGLYYIGFFSSMFFITLMSVDRYLAIVHAVYAI KVRTASVGTALSLTVWLAAVTATIPLMVFYQVASE DGMLQCFQFYEEQSLRWKLFTHFEINALGLLLPFA ILLFCYVRILQQLRGCLNHNRTRAIKLVLTVVIVS LLF
Protein Familie	G-protein coupled receptor 1 family
Citations	"Analysis of post-translational CCR8 modifications and their influence on receptor activity." Gutierrez J., Kremer L., Zaballos A., Goya I., Martinez-A C., Marquez G. J. Biol. Chem. 279:14726-14733(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD_antigen: CDw198 (Cmkbr8) (Ter1) (C-C CKR-8) (CC-CKR-8) (CCR-8)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	42.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Immunology
Relevance	Receptor for the CCL1/SCY1/TCA-3 chemokine.
Expression Region	1-353aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for the CCL1/SCY1/TCA-3 chemokine.
Subcellular Location	Cell membrane, Multi-pass membrane protein
Tissue Specificity	Expressed in thymus.
Gene Names	Ccr8
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF004847MO-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern