Vergleich

Recombinant Human Progesterone-induced-blocking factor 1(PIBF1)

ArtNr CSB-CF845171HU-50
Hersteller Cusabio
Menge 50 ug
Quantity options 10 ug 100 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Konjugat/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSRKISKESKKVNISSSLESEDISLETTVPTDDIS SSEEREGKVRITRQLIERKELLHNIQLLKIELSQK TMMIDNLKVDYLTKIEELEEKLNDALHQKQLLTLR LDNQLAFQQKDASKYQELMKQEMETILLRQKQLEE TNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPED QLSIPEYVSVRFYELVNPLRKEICELQVKKNILAE ELSTNKNQLKQLTETYEEDRKNYSEVQIRCQRLAL ELA
Citations "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Centrosomal protein of 90KDA
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
94.8 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Signal Transduction
Relevance
Isoform 1: Pericentriolar protein required to maintain mitotic spindle pole integrity. Required for the centrosomal accumulation of PCM1 and the recruitment of centriolar satellite proteins such as BBS4. Via association with PCM1 may be involved in primary cilia formation. Required for CEP63 centrosomal localization and its interaction with WDR62. Together with CEP63 promotes centriole duplication. Promotes the centrosomal localization of CDK2.
Isoform 4: The secreted form is a mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling decidual naturakl killer cells (NK) activity exerts an anti-abortive effect. Increases the production of Th2-type cytokines by signaling via the JAK/STAT pathway. Activates STAT6 and inhibits STAT4 phosphorylation. Signaling via a not identified receptor seems to implicate IL4R and a GPI-anchored protein
Expression Region
1-757aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Isoform 1
Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, Secreted, Note=In progesterone-treated astrocytoma cells a 57 kDa protein and isoform 1 (90 kDa) have been described, both being located in the intracellular medium and secreted, Respective predominant forms are isoform 1 in the intracellular and the 57 kDa protein in the extracellular medium (PubMed:25218441), SUBCELLULAR LOCATION: Isoform 1: Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite, Secreted, Note=Localizes to centriolar satellites throughout the cell cycle, SUBCELLULAR LOCATION: Isoform 4: Secreted
Tissue Specificity
Expressed at highest levels in testis. Moderate expression is detected in spleen, thymus, prostate, ovary, small intestine, and colon (PubMed:11935316). Expressed in the first trimester pregnancy decidua (PubMed:12516630). Localized to extravillous cytotrophoblast (at protein level). Also found in syncytiotrophoblast and part of the villous cytotrophoblast. Isoform 1 is expressed in first trimester and term villous trophoblast; trophoblast cells can additionally express other isoforms (PubMed:18817979). Overexpresed in solid tumors from stomach and uterus and in cells from ovary, cervical, breast, lymphoma and leukemia cancer (PubMed:25218441).
Involvement in disease
May be associated with microcephaly.
Gene Names
PIBF1
Sequence Info
Full Length
Organism
Homo sapiens(Human)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen