« Zurück
Startseite /
Recombinant Rat Steroid 17-alpha-hydroxylase/17,20 lyase(Cyp17a1)

Recombinant Rat Steroid 17-alpha-hydroxylase/17,20 lyase(Cyp17a1)

ArtNr	CSB-EP006392RA-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Food Safety Hormones Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MWELVGLLLLILAYFFWVKSKTPGAKLPRSLPSLP LVGSLPFLPRRGHMHVNFFKLQEKYGPIYSLRLGT TTTVIIGHYQLAREVLIKKGKEFSGRPQMVTQSLL SDQGKGVAFADAGSSWHLHRKLVFSTFSLFKDGQK LEKLICQEAKSLCDMMLAHDKESIDLSTPIFMSVT NIICAICFNISYEKNDPKLTAIKTFTEGIVDATGD RNLVDIFPWLTIFPNKGLEVIKGYAKVRNEVLTGI FEK
Protein Familie	Cytochrome P450 family
Citations	"Rat P450(17 alpha) from testis: characterization of a full-length cDNA encoding a unique steroid hydroxylase capable of catalyzing both delta 4- and delta 5-steroid-17,20-lyase reactions."Fevold H.R., Lorence M.C., McCarthy J.L., Trant J.M., Kagimoto M., Waterman M.R., Mason J.I.Mol. Endocrinol. 3:968-975(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	17-alpha-hydroxyprogesterone aldolase,CYPXVII,Cytochrome P450 17A1,Cytochrome P450-C17,Cytochrome P450c17
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	73.3 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Metabolism
Relevance	Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17, 20-lyase reaction. Involved in sexual development during fetal life and at puberty.
Expression Region	1-507aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17, 20-lyase reaction. Involved in sexual development during fetal life and at puberty.
Subcellular Location	Membrane
Gene Names	Cyp17a1
Sequence Info	Full Length
Organism	Rattus norvegicus (Rat)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP006392RA-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern