Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-EP006392RA-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Metabolism |
Uniprot ID |
P11715 |
Gene Names |
Cyp17a1 |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
MWELVGLLLLILAYFFWVKSKTPGAKLPRSLPSLP LVGSLPFLPRRGHMHVNFFKLQEKYGPIYSLRLGT TTTVIIGHYQLAREVLIKKGKEFSGRPQMVTQSLL SDQGKGVAFADAGSSWHLHRKLVFSTFSLFKDGQK LEKLICQEAKSLCDMMLAHDKESIDLSTPIFMSVT NIICAICFNISYEKNDPKLTAIKTFTEGIVDATGD RNLVDIFPWLTIFPNKGLEVIKGYAKVRNEVLTGI FEKCREKFDSQSISSLTDILIQAKMNSDNNNSCEG RDPDVFSDRHILATVGDIFGAGIETTTTVLKWILA FLVHNPEVKKKIQKEIDQYVGFSRTPTFNDRSHLL MLEATIREVLRIRPVAPMLIPHKANVDSSIGEFTV PKDTHVVVNLWALHHDENEWDQPDQFMPERFLDPT GSHLITPTQSYLPFGAGPRSCIGEALARQELFVFT ALLLQRFDLDVSDDKQLPRLEGDPKVVFLIDPFKV KITVRQAWMDAQAEVST |
Expression Region |
1-507aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
73.3 kDa |
Alternative Name(s) |
17-alpha-hydroxyprogesterone aldolase CYPXVII Cytochrome P450 17A1 Cytochrome P450-C17 Short name: Cytochrome P450c17 |
Relevance |
Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17, 20-lyase reaction. Involved in sexual development during fetal life and at puberty. |
Reference |
"Rat P450(17 alpha) from testis: characterization of a full-length cDNA encoding a unique steroid hydroxylase capable of catalyzing both delta 4- and delta 5-steroid-17, 20-lyase reactions."Fevold H.R., Lorence M.C., McCarthy J.L., Trant J.M., Kagimoto M., Waterman M.R., Mason J.I.Mol. Endocrinol. 3:968-975(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17, 20-lyase reaction. Involved in sexual development during fetal life and at puberty. |
Subcellular Location |
Membrane |
Protein Families |
Cytochrome P450 family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.