« Zurück
Home /
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Hersteller	Cusabio
Kategorie	Food Safety Histamines Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-EP008532HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Immunology
Target / Protein	FCER1A
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P12319
AA Sequence	VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQH QQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFL RCHGWRNWDVYKVIYYKDGEALKYWYENHNISITN ATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPRE KYWLQ
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	26-205aa
Protein length	Extracellular Domain
MW	37 kDa
Alternative Name(s)	c-epsilon RI-alpha Short name: FcERI IgE Fc receptor subunit alpha
Relevance	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
References	"The E237G polymorphism of the high-affinity IgE receptor beta chain and asthma."Zhang X., Zhang W., Qiu D., Sandford A., Tan W.C.Ann. Allergy Asthma Immunol. 93:499-503(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Paythway	FcepsilonRIsignalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP008532HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen