Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-EP008532HU-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Immunology |
Target / Protein |
FCER1A |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P12319 |
AA Sequence |
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQH QQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFL RCHGWRNWDVYKVIYYKDGEALKYWYENHNISITN ATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPRE KYWLQ |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
26-205aa |
Protein length |
Extracellular Domain |
MW |
37 kDa |
Alternative Name(s) |
c-epsilon RI-alpha Short name: FcERI IgE Fc receptor subunit alpha |
Relevance |
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. |
References |
"The E237G polymorphism of the high-affinity IgE receptor beta chain and asthma."Zhang X., Zhang W., Qiu D., Sandford A., Tan W.C.Ann. Allergy Asthma Immunol. 93:499-503(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. |
Subcellular Location |
Cell membrane, Single-pass type I membrane protein |
Paythway |
FcepsilonRIsignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.