« Zurück
Home /
Recombinant Human Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial(GATC)

Recombinant Human Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial(GATC)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009283HU-10
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	O43716
Gene Names	GATC
Organism	Homo sapiens (Human)
AA Sequence	MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAA VIEHLERLALVDFGSREAVARLEKAIAFADRLRAV DTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQ NSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
Expression Region	1-136aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	42.1 kDa
Alternative Name(s)	Protein 15E1.2
Relevance	Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Reference	"Biogenesis of glutaminyl-mt tRNAGln in human mitochondria." Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T. Proc. Natl. Acad. Sci. U.S.A. 106:16209-16214(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Subcellular Location	Mitochondrion
Protein Families	GatC family
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen