Recombinant Human Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial(GATC)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP009283HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
O43716
Gene Names
GATC
Organism
Homo sapiens (Human)
AA Sequence
MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAA VIEHLERLALVDFGSREAVARLEKAIAFADRLRAV DTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQ NSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
Expression Region
1-136aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
42.1 kDa
Alternative Name(s)
Protein 15E1.2
Relevance
Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Reference
"Biogenesis of glutaminyl-mt tRNAGln in human mitochondria."
Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T.
Proc. Natl. Acad. Sci. U.S.A. 106:16209-16214(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close