Comparison

Recombinant Human Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial(GATC)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009283HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Protein 15E1.2
AA Sequence
MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAA VIEHLERLALVDFGSREAVARLEKAIAFADRLRAV DTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQ NSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
Research Topic
others
Uniprot ID
O43716
Gene Names
GATC
Tag Info
N-terminal GST-tagged
Expression Region
1-136aa
MW of Fusion Proten
42, 1
Sequence Info
Full Length
Relevance
Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Reference
"Biogenesis of glutaminyl-mt tRNAGln in human mitochondria."
Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T.
Proc. Natl. Acad. Sci. U.S.A. 106:16209-16214(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close