« Zurück
Home /
Recombinant Human Haptoglobin(HP)

Recombinant Human Haptoglobin(HP)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Specific against	other
Menge	10ug
ArtNr	CSB-EP010691HU(A4)-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cardiovascular
Uniprot ID	P00738
Gene Names	HP
Organism	Homo sapiens (Human)
AA Sequence	VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCK NYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEA DDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDG VYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANP VQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLIN EQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKK QLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVM PICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKY VMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPI LNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDT WYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTI AEN
Expression Region	19-406aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-B2M-tagged
MW	57.3 kDa
Alternative Name(s)	Alternative name(s): Zonulin
Relevance	As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
Reference	"Evolution of haptoglobin: comparison of complementary DNA encoding Hp alpha 1S and Hp alpha 2FS." Brune J.L., Yang F., Barnett D.R., Bowman B.H. Nucleic Acids Res. 12:4531-4538(1984)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
Involvement in disease	Anhaptoglobinemia (AHP)
Subcellular Location	Secreted
Protein Families	Peptidase S1 family
Tissue Specificity	Expressed by the liver and secreted in plasma.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen