Comparison

Recombinant Human Haptoglobin(HP)

Item no. CSB-EP010691HU(A4)-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCK NYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEA DDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDG VYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANP VQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLIN EQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKK QLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVM PIC
Protein Family Peptidase S1 family
Citations "Evolution of haptoglobin: comparison of complementary DNA encoding Hp alpha 1S and Hp alpha 2FS."
Brune J.L., Yang F., Barnett D.R., Bowman B.H.
Nucleic Acids Res. 12:4531-4538(1984)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Alternative name(s):; Zonulin
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-B2M-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
57.3 kDa
General Research Areas
Cardiovascular
Relevance
As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
Expression Region
19-406aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
Subcellular Location
Secreted
Tissue Specificity
Expressed by the liver and secreted in plasma.
Involvement in disease
Anhaptoglobinemia (AHP)
Gene Names
HP
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close