« Zurück
Startseite /
Recombinant Human Histamine H1 receptor(HRH1),partial

Recombinant Human Histamine H1 receptor(HRH1),partial

ArtNr	CSB-EP010737HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Histamines Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPK GDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTP KEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAE GSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ MLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLD YIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ
Protein Familie	G-protein coupled receptor 1 family
Citations	"Molecular cloning of the human histamine H1 receptor gene."Fukui K., Fujimoto K., Mizuguchi H., Sakamoto K., Horio Y., Takai S., Yamada K., Ito S.Biochem. Biophys. Res. Commun. 201:894-901(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	H1R,HH1R
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	27.1 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Immunology
Relevance	In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Expression Region	211-416aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Subcellular Location	Cell membrane, Multi-pass membrane protein
Pathway	Calciumsignalingpathway
Gene Names	HRH1
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP010737HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern