« Zurück
Home /
Recombinant Human Histamine H1 receptor(HRH1),partial

Recombinant Human Histamine H1 receptor(HRH1),partial

Hersteller	Cusabio
Kategorie	Food Safety Histamines Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP010737HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Immunology
Uniprot ID	P35367
Gene Names	HRH1
Organism	Homo sapiens (Human)
AA Sequence	AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPK GDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTP KEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAE GSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ MLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLD YIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ
Expression Region	211-416aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	27.1 kDa
Alternative Name(s)	Short name:H1R Short name:HH1R
Relevance	In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Reference	"Molecular cloning of the human histamine H1 receptor gene."Fukui K., Fujimoto K., Mizuguchi H., Sakamoto K., Horio Y., Takai S., Yamada K., Ito S.Biochem. Biophys. Res. Commun. 201:894-901(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Subcellular Location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 1 family
Paythway	Calciumsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen