Recombinant Human Histamine H1 receptor(HRH1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP010737HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P35367
Gene Names
HRH1
Organism
Homo sapiens (Human)
AA Sequence
AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPK GDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTP KEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAE GSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ MLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLD YIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ
Expression Region
211-416aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
MW
27.1 kDa
Alternative Name(s)
Short name:H1R
Short name:HH1R
Relevance
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Reference
"Molecular cloning of the human histamine H1 receptor gene."Fukui K., Fujimoto K., Mizuguchi H., Sakamoto K., Horio Y., Takai S., Yamada K., Ito S.Biochem. Biophys. Res. Commun. 201:894-901(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close