Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP014597HU(A4)-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Cell Cycle |
Uniprot ID |
P46013 |
Gene Names |
MKI67 |
Organism |
Homo sapiens (Human) |
AA Sequence |
RKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELS QTPGHTEELANGAADSFTSAPKQTPDSGKPLKISR RVLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLP FKRGGGKDGSVTGTKRLRCMPAPEEIVEELPASKK QRVAPRARGKSSEPVVIMKRSLRTSAKRIEPAEEL NSNDMKTNKEEHKLQDSVPENKGISLRSRRQNKTE AEQQITEVFVLAERIEINRNEKKPMKTSPEMDIQN PDDGARKPIPRDKVTENKRCLRSARQNESSQPKVA EESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKT KSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNV CVKKIRTRSHRDSEDI |
Expression Region |
2891-3256aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
56.6 kDa |
Relevance |
Thought to be required for maintaining cell proliferation. |
Reference |
Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.Ahmad Y., Boisvert F.M., Lundberg E., Uhlen M., Lamond A.I.Mol. Cell. Proteomics 11:M111.013680.01-M111.013680.15(2012) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly |
Subcellular Location |
Chromosome, Nucleus, Nucleus, nucleolus |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.